Lineage for d6ieah1 (6iea H:6-225)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756084Domain d6ieah1: 6iea H:6-225 [411313]
    Other proteins in same PDB: d6ieah2, d6ieal2
    automated match to d6shgh_
    complexed with gol, peg

Details for d6ieah1

PDB Entry: 6iea (more details), 2 Å

PDB Description: structure of rvfv gn and human monoclonal antibody r13
PDB Compounds: (H:) R13 H chain

SCOPe Domain Sequences for d6ieah1:

Sequence, based on SEQRES records: (download)

>d6ieah1 b.1.1.0 (H:6-225) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsqtlsltctvsggsissggyywswirqhpgkglewigyiydsgstyynpsl
ksrvtisvdtsknqfslklssvtaadtalyycaslpycsgricrprtdywgqgtlvtvss
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d6ieah1 b.1.1.0 (H:6-225) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsqtlsltctvsggsissggyywswirqhpgkglewigyiydsgstyynpsl
ksrvtisvdtsknqfslklssvtaadtalyycaslpycsgricrprtdywgqgtlvtvss
astkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvptyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d6ieah1:

Click to download the PDB-style file with coordinates for d6ieah1.
(The format of our PDB-style files is described here.)

Timeline for d6ieah1:

  • d6ieah1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6ieah2