SCOP 1.63: Domain d1ordb3: 1ord B:570-730

Lineage for d1ordb3 (1ord B:570-730)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.125: Ornithine decarboxylase C-terminal domain [55903] (1 superfamily)
   complex alpha+beta motif

4. Superfamily d.125.1: Ornithine decarboxylase C-terminal domain [55904] (1 family)

5. Family d.125.1.1: Ornithine decarboxylase C-terminal domain [55905] (1 protein)

6. Protein Ornithine decarboxylase C-terminal domain [55906] (1 species)

7. Species Lactobacillus sp., strain 30a [TaxId:1591] [55907] (2 PDB entries)

8. Domain d1ordb3: 1ord B:570-730 [41125]
   Other proteins in same PDB: d1orda1, d1orda2, d1ordb1, d1ordb2
   complexed with plp

Details for d1ordb3

PDB Entry: 1ord, 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution

SCOP Domain Sequences for d1ordb3:

Sequence; same for both SEQRES and ATOM records:

>d1ordb3 d.125.1.1 (B:570-730) Ornithine decarboxylase C-terminal domain {Lactobacillus sp., strain 30a}
aplkqvlpsiyaaneeryngytirelcqelhdfyknnntftyqkrlflreffpeqgmlpy
earqefirnhnklvplnkiegeialegalpyppgvfcvapgekwsetavkyftilqdgin
nfpgfapeiqgvyfkqegdkvvaygevydaevaknddrynn

Timeline for d1ordb3:

• d1ordb3 first appeared (with stable ids) in SCOP 1.55
  
• d1ordb3 appears in SCOP 1.61
  
• d1ordb3 appears in SCOP 1.65
  
• d1ordb3 appears in the current release, SCOPe 2.08