Lineage for d1ordb3 (1ord B:570-730)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196322Fold d.125: Ornithine decarboxylase C-terminal domain [55903] (1 superfamily)
  4. 196323Superfamily d.125.1: Ornithine decarboxylase C-terminal domain [55904] (1 family) (S)
  5. 196324Family d.125.1.1: Ornithine decarboxylase C-terminal domain [55905] (1 protein)
  6. 196325Protein Ornithine decarboxylase C-terminal domain [55906] (1 species)
  7. 196326Species Lactobacillus sp., strain 30a [TaxId:1591] [55907] (2 PDB entries)
  8. 196329Domain d1ordb3: 1ord B:570-730 [41125]
    Other proteins in same PDB: d1orda1, d1orda2, d1ordb1, d1ordb2

Details for d1ordb3

PDB Entry: 1ord (more details), 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution

SCOP Domain Sequences for d1ordb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ordb3 d.125.1.1 (B:570-730) Ornithine decarboxylase C-terminal domain {Lactobacillus sp., strain 30a}
aplkqvlpsiyaaneeryngytirelcqelhdfyknnntftyqkrlflreffpeqgmlpy
earqefirnhnklvplnkiegeialegalpyppgvfcvapgekwsetavkyftilqdgin
nfpgfapeiqgvyfkqegdkvvaygevydaevaknddrynn

SCOP Domain Coordinates for d1ordb3:

Click to download the PDB-style file with coordinates for d1ordb3.
(The format of our PDB-style files is described here.)

Timeline for d1ordb3: