Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.125: Ornithine decarboxylase C-terminal domain [55903] (1 superfamily) complex alpha+beta motif |
Superfamily d.125.1: Ornithine decarboxylase C-terminal domain [55904] (1 family) automatically mapped to Pfam PF03711 |
Family d.125.1.1: Ornithine decarboxylase C-terminal domain [55905] (1 protein) |
Protein Ornithine decarboxylase C-terminal domain [55906] (1 species) |
Species Lactobacillus sp., strain 30a [TaxId:1591] [55907] (2 PDB entries) |
Domain d1orda3: 1ord A:570-730 [41124] Other proteins in same PDB: d1orda1, d1orda2, d1ordb1, d1ordb2 complexed with plp |
PDB Entry: 1ord (more details), 3 Å
SCOPe Domain Sequences for d1orda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orda3 d.125.1.1 (A:570-730) Ornithine decarboxylase C-terminal domain {Lactobacillus sp., strain 30a [TaxId: 1591]} aplkqvlpsiyaaneeryngytirelcqelhdfyknnntftyqkrlflreffpeqgmlpy earqefirnhnklvplnkiegeialegalpyppgvfcvapgekwsetavkyftilqdgin nfpgfapeiqgvyfkqegdkvvaygevydaevaknddrynn
Timeline for d1orda3: