Lineage for d1dixa_ (1dix A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83656Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
  4. 83657Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) (S)
  5. 83658Family d.124.1.1: Ribonuclease Rh-like [55896] (3 proteins)
  6. 83665Protein RNase LE [55901] (1 species)
  7. 83666Species Tomatoes (Lycopersicon esculentum) [TaxId:4081] [55902] (1 PDB entry)
  8. 83667Domain d1dixa_: 1dix A: [41122]

Details for d1dixa_

PDB Entry: 1dix (more details), 1.65 Å

PDB Description: crystal structure of rnase le

SCOP Domain Sequences for d1dixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dixa_ d.124.1.1 (A:) RNase LE {Tomatoes (Lycopersicon esculentum)}
asgskdfdffyfvqqwpgsycdtkqsccypttgkpaadfgihglwpnnndgtypsncdpn
spydqsqisdlissmqqnwptlacpsgsgstfwshewekhgtcaesvltnqhayfkkald
lknqidllsilqgadihpdgesydlvnirnaiksaigytpwiqcnvdqsgnsqlyqvyic
vdgsgssliecpifpggkcgtsiefptf

SCOP Domain Coordinates for d1dixa_:

Click to download the PDB-style file with coordinates for d1dixa_.
(The format of our PDB-style files is described here.)

Timeline for d1dixa_: