Lineage for d1dixa_ (1dix A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily) Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) 
Family d.124.1.1: Ribonuclease Rh-like [55896] (3 proteins) 
Protein RNase LE [55901] (1 species) Species Tomatoes (Lycopersicon esculentum) [TaxId:4081] [55902] (1 PDB entry) 
Domain d1dixa_: 1dix A: [41122]
Details for d1dixa_
PDB Entry: 1dix (more details), 1.65 Å
PDB Description: crystal structure of rnase le
SCOP Domain Sequences for d1dixa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dixa_ d.124.1.1 (A:) RNase LE {Tomatoes (Lycopersicon esculentum)}
asgskdfdffyfvqqwpgsycdtkqsccypttgkpaadfgihglwpnnndgtypsncdpn
spydqsqisdlissmqqnwptlacpsgsgstfwshewekhgtcaesvltnqhayfkkald
lknqidllsilqgadihpdgesydlvnirnaiksaigytpwiqcnvdqsgnsqlyqvyic
vdgsgssliecpifpggkcgtsiefptf
SCOP Domain Coordinates for d1dixa_:
Click to download the PDB-style file with coordinates for d1dixa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dixa_:
- d1dixa_ appears in SCOP 1.57
- d1dixa_ appears in the current release, SCOPe 2.08
View in 3D