Lineage for d1dixa_ (1dix A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. Protein RNase LE [55901] (1 species)
  7. Species Tomato (Lycopersicon esculentum) [TaxId:4081] [55902] (1 PDB entry)
  8. Domain d1dixa_: 1dix A: [41122]

Details for d1dixa_

PDB Entry: 1dix (more details), 1.6500000000000001 Å

PDB Description: crystal structure of rnase le
PDB Compounds: (A:) extracellular ribonuclease le

SCOPe Domain Sequences for d1dixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dixa_ d.124.1.1 (A:) RNase LE {Tomato (Lycopersicon esculentum) [TaxId: 4081]}
asgskdfdffyfvqqwpgsycdtkqsccypttgkpaadfgihglwpnnndgtypsncdpn
spydqsqisdlissmqqnwptlacpsgsgstfwshewekhgtcaesvltnqhayfkkald
lknqidllsilqgadihpdgesydlvnirnaiksaigytpwiqcnvdqsgnsqlyqvyic
vdgsgssliecpifpggkcgtsiefptf

SCOPe Domain Coordinates for d1dixa_ are not available.

Timeline for d1dixa_: