Lineage for d6high_ (6hig H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760385Domain d6high_: 6hig H: [411219]
    Other proteins in same PDB: d6higl2
    automated match to d6shgh_

Details for d6high_

PDB Entry: 6hig (more details), 2.2 Å

PDB Description: hpd-1/nbo1a fab complex
PDB Compounds: (H:) heavy chain

SCOPe Domain Sequences for d6high_:

Sequence, based on SEQRES records: (download)

>d6high_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvqsgaevkkpgeslkisckgsgysftnfyihwvrqapgqrlewmgsiypnygdtay
nqkfkdrfvfsldtsvstaylqisslkaedtavyycargysyamdywgqgttvtvssast
kgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtktytcnvdhkpsntkvdkrves

Sequence, based on observed residues (ATOM records): (download)

>d6high_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvqsgaevkkpgeslkisckgsgysftnfyihwvrqapgqrlewmgsiypnygdtay
nqkfkdrfvfsldtsvstaylqisslkaedtavyycargysyamdywgqgttvtvssast
kgpsvfplapcstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslktytcnvdhkpsntkvdkrves

SCOPe Domain Coordinates for d6high_:

Click to download the PDB-style file with coordinates for d6high_.
(The format of our PDB-style files is described here.)

Timeline for d6high_:

  • d6high_ is new in SCOPe 2.08-stable