![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
![]() | Protein automated matches [190728] (15 species) not a true protein |
![]() | Species Azotobacter vinelandii [TaxId:322710] [258948] (19 PDB entries) |
![]() | Domain d6h6wb_: 6h6w B: [411203] automated match to d6rj4e_ complexed with 8m0, atp, fuq, mg, mo, moo, po4 |
PDB Entry: 6h6w (more details), 1.9 Å
SCOPe Domain Sequences for d6h6wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h6wb_ c.73.1.0 (B:) automated matches {Azotobacter vinelandii [TaxId: 322710]} nstaeleellmqrsltdpqlqaaaaaaadfrilpdatvikiggqsvidrgraavyplvde ivaarknhklligtgagtrarhlysiaaglglpagvlaqlgssvadqnaamlgqllakhg ipvvggaglsavplslaevnavvfsgmppyklwmrpaaegvippyrtdagcfllaeqfgc kqmifvkdedglytanpktskdatfiprisvdemkakglhdsilefpvldllqsaqhvre vqvvnglvpgnltralagehvgtiitas
Timeline for d6h6wb_: