SCOP 1.63: Domain d1bola_: 1bol A:

Lineage for d1bola_ (1bol A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (6 proteins)

6. Protein Ribonuclease Rh [55897] (1 species)

7. Species Rhizopus niveus [TaxId:4844] [55898] (1 PDB entry)

8. Domain d1bola_: 1bol A: [41120]

Details for d1bola_

PDB Entry: 1bol, 2 Å

PDB Description: the crystal structure of ribonuclease rh from rhizopus niveus at 2.0 a resolution

SCOP Domain Sequences for d1bola_:

Sequence; same for both SEQRES and ATOM records:

>d1bola_ d.124.1.1 (A:) Ribonuclease Rh {Rhizopus niveus}
sscsstalscsnsansdtccspeyglvvlnmqwapgygpdnaftlhglwpdkcsgayaps
ggcdsnrasssiasvikskdsslynsmltywpsnqgnnnvfwshewskhgtcvstydpdc
ydnyeegedivdyfqkamdlrsqynvykafssngitpggtytatemqsaiesyfgakaki
dcssgtlsdvalyfyvrgrdtyvitdalstgscsgdveyptk

Timeline for d1bola_:

• d1bola_ first appeared (with stable ids) in SCOP 1.55
  
• d1bola_ appears in SCOP 1.61
  
• d1bola_ appears in SCOP 1.65
  
• d1bola_ appears in the current release, SCOPe 2.08