Lineage for d6h6ma_ (6h6m A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822727Species Murine norovirus gv/cr10/2005/usa [TaxId:463724] [347267] (2 PDB entries)
  8. 2822730Domain d6h6ma_: 6h6m A: [411199]
    Other proteins in same PDB: d6h6me_, d6h6mf_
    automated match to d5or7a_
    complexed with cho, edo, na, peg, pge

Details for d6h6ma_

PDB Entry: 6h6m (more details), 2.38 Å

PDB Description: cr10 murine norovirus protruding domain in complex with the cd300lf receptor and glycochenodeoxycholate (gcdca)
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d6h6ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h6ma_ b.121.4.0 (A:) automated matches {Murine norovirus gv/cr10/2005/usa [TaxId: 463724]}
rmvdlpvlqprlctharwpapiygllvdpslpsnpqwqngrvhvdgtllgttpvsgswvs
cfaaeaayefqsgtgevatftlieqdgsayvpgdraaplgypdfsgqleievqtettktg
dklkvttfemilgpttnvdqapyqgrvyasltavasldlvdgrvravprsiygfqdvipe
yndgllvplappigpflpgevllrfrtymrqldtadaaaeaidcalpqefiswfasnaft
vqsdalllryrntltgqllfecklysegyialsysgsgpltfptdgffevvswvprlfql
asv

SCOPe Domain Coordinates for d6h6ma_:

Click to download the PDB-style file with coordinates for d6h6ma_.
(The format of our PDB-style files is described here.)

Timeline for d6h6ma_:

  • d6h6ma_ is new in SCOPe 2.08-stable