Lineage for d6h3ha1 (6h3h A:6-222)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744507Domain d6h3ha1: 6h3h A:6-222 [411191]
    Other proteins in same PDB: d6h3ha2, d6h3hb1, d6h3hb2, d6h3hc2, d6h3hd1, d6h3hd2
    automated match to d6shgh_
    complexed with gol, so4

Details for d6h3ha1

PDB Entry: 6h3h (more details), 1.92 Å

PDB Description: fab fragment of antibody against fullerene c60
PDB Compounds: (A:) Anti-fullerene antibody Fab fragment Heavy chain

SCOPe Domain Sequences for d6h3ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h3ha1 b.1.1.1 (A:6-222) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsaaelarpgasvkmsckasgytftrytmhwikqrpgqglewigyinpssgyteynqkfr
dkttltadkssstaymqlssltsedsavyycargdyryggtaywgqgtlvtvsaakttap
svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkidpagps

SCOPe Domain Coordinates for d6h3ha1:

Click to download the PDB-style file with coordinates for d6h3ha1.
(The format of our PDB-style files is described here.)

Timeline for d6h3ha1:

  • d6h3ha1 is new in SCOPe 2.08-stable