![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d6h3ha1: 6h3h A:6-222 [411191] Other proteins in same PDB: d6h3ha2, d6h3hb1, d6h3hb2, d6h3hc2, d6h3hd1, d6h3hd2 automated match to d6shgh_ complexed with gol, so4 |
PDB Entry: 6h3h (more details), 1.92 Å
SCOPe Domain Sequences for d6h3ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h3ha1 b.1.1.1 (A:6-222) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qsaaelarpgasvkmsckasgytftrytmhwikqrpgqglewigyinpssgyteynqkfr dkttltadkssstaymqlssltsedsavyycargdyryggtaywgqgtlvtvsaakttap svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss svtvtsstwpsqsitcnvahpasstkvdkkidpagps
Timeline for d6h3ha1: