Lineage for d6h2yh_ (6h2y H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758774Domain d6h2yh_: 6h2y H: [411188]
    Other proteins in same PDB: d6h2yl2
    automated match to d6shgh_
    complexed with edo, p33, peg, pg4

Details for d6h2yh_

PDB Entry: 6h2y (more details), 2.65 Å

PDB Description: human fab 1e6 bound to fhbp variant 3 from neisseria meningitidis serogroup b
PDB Compounds: (H:) heavy chain

SCOPe Domain Sequences for d6h2yh_:

Sequence, based on SEQRES records: (download)

>d6h2yh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgssvkvsckasggtvidypitwvrqapgqglewvggfvplfrtsny
gqkfqgrvtitadkststasmelnsltsedtaiyycargdtamgpfdywgqgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc

Sequence, based on observed residues (ATOM records): (download)

>d6h2yh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgssvkvsckasggtvidypitwvrqapgqglewvggfvplfrtsny
gqkfqgrvtitadkststasmelnsltsedtaiyycargdtamgpfdywgqgtlvtvssa
stkgpsvfplapssksgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc

SCOPe Domain Coordinates for d6h2yh_:

Click to download the PDB-style file with coordinates for d6h2yh_.
(The format of our PDB-style files is described here.)

Timeline for d6h2yh_:

  • d6h2yh_ is new in SCOPe 2.08-stable