Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily) core: alpha-beta-alpha-beta(2)-(alpha)-beta(2) |
Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family) Histidine kinase-like fold lacking the kinase ATP-binding site |
Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein) |
Protein Sporulation response regulatory protein Spo0B [55892] (1 species) |
Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries) |
Domain d1f51c_: 1f51 C: [41118] Other proteins in same PDB: d1f51e_, d1f51f_, d1f51g_, d1f51h_ complexed with mg |
PDB Entry: 1f51 (more details), 3 Å
SCOPe Domain Sequences for d1f51c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f51c_ d.123.1.1 (C:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl d
Timeline for d1f51c_: