Lineage for d1f51c_ (1f51 C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35567Fold d.123: Sporulation responce regulatory protein Spo0B [55889] (1 superfamily)
  4. 35568Superfamily d.123.1: Sporulation responce regulatory protein Spo0B [55890] (1 family) (S)
  5. 35569Family d.123.1.1: Sporulation responce regulatory protein Spo0B [55891] (1 protein)
  6. 35570Protein Sporulation responce regulatory protein Spo0B [55892] (1 species)
  7. 35571Species Bacillus subtilis [TaxId:1423] [55893] (2 PDB entries)
  8. 35576Domain d1f51c_: 1f51 C: [41118]
    Other proteins in same PDB: d1f51e_, d1f51f_, d1f51g_, d1f51h_

Details for d1f51c_

PDB Entry: 1f51 (more details), 3 Å

PDB Description: a transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction

SCOP Domain Sequences for d1f51c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f51c_ d.123.1.1 (C:) Sporulation responce regulatory protein Spo0B {Bacillus subtilis}
isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl
ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen
hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
d

SCOP Domain Coordinates for d1f51c_:

Click to download the PDB-style file with coordinates for d1f51c_.
(The format of our PDB-style files is described here.)

Timeline for d1f51c_: