Lineage for d6gujb_ (6guj B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905281Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2905282Protein automated matches [190728] (15 species)
    not a true protein
  7. 2905283Species Azotobacter vinelandii [TaxId:322710] [258948] (18 PDB entries)
  8. 2905324Domain d6gujb_: 6guj B: [411175]
    automated match to d6rj4e_
    complexed with 8m0, atp, mg, mo, moo

Details for d6gujb_

PDB Entry: 6guj (more details), 2.1 Å

PDB Description: molybdenum storage protein with two occupied atp binding sites
PDB Compounds: (B:) Molybdenum storage protein subunit beta

SCOPe Domain Sequences for d6gujb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gujb_ c.73.1.0 (B:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
nstaeleellmqrsltdpqlqaaaaaaadfrilpdatvikiggqsvidrgraavyplvde
ivaarknhklligtgagtrarhlysiaaglglpagvlaqlgssvadqnaamlgqllakhg
ipvvggaglsavplslaevnavvfsgmppyklwmrpaaegvippyrtdagcfllaeqfgc
kqmifvkdedglytanpktskdatfiprisvdemkakglhdsilefpvldllqsaqhvre
vqvvnglvpgnltralagehvgtiitas

SCOPe Domain Coordinates for d6gujb_:

Click to download the PDB-style file with coordinates for d6gujb_.
(The format of our PDB-style files is described here.)

Timeline for d6gujb_:

  • d6gujb_ is new in SCOPe 2.08-stable