Lineage for d1f51b_ (1f51 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213732Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha)-beta(2)
  4. 2213733Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family) (S)
    Histidine kinase-like fold lacking the kinase ATP-binding site
  5. 2213734Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein)
  6. 2213735Protein Sporulation response regulatory protein Spo0B [55892] (1 species)
  7. 2213736Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries)
  8. 2213744Domain d1f51b_: 1f51 B: [41117]
    Other proteins in same PDB: d1f51e_, d1f51f_, d1f51g_, d1f51h_
    complexed with mg

Details for d1f51b_

PDB Entry: 1f51 (more details), 3 Å

PDB Description: a transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction
PDB Compounds: (B:) sporulation initiation phosphotransferase b

SCOPe Domain Sequences for d1f51b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f51b_ d.123.1.1 (B:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
ld

SCOPe Domain Coordinates for d1f51b_:

Click to download the PDB-style file with coordinates for d1f51b_.
(The format of our PDB-style files is described here.)

Timeline for d1f51b_: