Lineage for d6fy2h_ (6fy2 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757079Domain d6fy2h_: 6fy2 H: [411154]
    Other proteins in same PDB: d6fy2l2, d6fy2y2
    automated match to d6shgh_
    complexed with gol, so4

Details for d6fy2h_

PDB Entry: 6fy2 (more details), 2.3 Å

PDB Description: crystal structure of a v2p-reactive rv144 vaccine-like antibody, cap228-16h, in complex with a heterologous cap225 v1v2
PDB Compounds: (H:) CAP228-16H Heavy Chain

SCOPe Domain Sequences for d6fy2h_:

Sequence, based on SEQRES records: (download)

>d6fy2h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgeslkisckgsgyrfpsswigwvrqvpgkglewmgiiypgdgetry
rasfqgqvtisadqssntaylqwsslkasdtamyycarhgrgvrevinafdiwgqgtmvt
vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d6fy2h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgeslkisckgsgyrfpsswigwvrqvpgkglewmgiiypgdgetry
rasfqgqvtisadqssntaylqwsslkasdtamyycarhgrgvrevinafdiwgqgtmvt
vssastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d6fy2h_:

Click to download the PDB-style file with coordinates for d6fy2h_.
(The format of our PDB-style files is described here.)

Timeline for d6fy2h_:

  • d6fy2h_ is new in SCOPe 2.08-stable