Lineage for d1ixmb_ (1ixm B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83645Fold d.123: Sporulation responce regulatory protein Spo0B [55889] (1 superfamily)
  4. 83646Superfamily d.123.1: Sporulation responce regulatory protein Spo0B [55890] (1 family) (S)
  5. 83647Family d.123.1.1: Sporulation responce regulatory protein Spo0B [55891] (1 protein)
  6. 83648Protein Sporulation responce regulatory protein Spo0B [55892] (1 species)
  7. 83649Species Bacillus subtilis [TaxId:1423] [55893] (2 PDB entries)
  8. 83651Domain d1ixmb_: 1ixm B: [41115]

Details for d1ixmb_

PDB Entry: 1ixm (more details), 2.6 Å

PDB Description: crystal structure of spoob from bacillus subtilis

SCOP Domain Sequences for d1ixmb_:

Sequence, based on SEQRES records: (download)

>d1ixmb_ d.123.1.1 (B:) Sporulation responce regulatory protein Spo0B {Bacillus subtilis}
nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
ld

Sequence, based on observed residues (ATOM records): (download)

>d1ixmb_ d.123.1.1 (B:) Sporulation responce regulatory protein Spo0B {Bacillus subtilis}
nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
nhltvslqtdhpdrqlilyldfhgafadpsafddivdimrfeitsheclieigld

SCOP Domain Coordinates for d1ixmb_:

Click to download the PDB-style file with coordinates for d1ixmb_.
(The format of our PDB-style files is described here.)

Timeline for d1ixmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ixma_