SCOPe 2.06: Domain d1ixma_: 1ixm A:

Lineage for d1ixma_ (1ixm A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily)
   core: alpha-beta-alpha-beta(2)-(alpha)-beta(2)

4. Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family)
   Histidine kinase-like fold lacking the kinase ATP-binding site

5. Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein)

6. Protein Sporulation response regulatory protein Spo0B [55892] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries)

8. Domain d1ixma_: 1ixm A: [41114]

Details for d1ixma_

PDB Entry: 1ixm, 2.6 Å

PDB Description: crystal structure of spoob from bacillus subtilis

PDB Compounds: (A:) protein (sporulation response regulatory protein)

SCOPe Domain Sequences for d1ixma_:

Sequence, based on SEQRES records:

>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
ltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl

Sequence, based on observed residues (ATOM records):

>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
ltvslqtdhpdrqlilyldfhgafadpsafdimrfeitsheclieigl

Timeline for d1ixma_:

• d1ixma_ first appeared (with stable ids) in SCOP 1.55
  
• d1ixma_ appears in SCOPe 2.05
  
• d1ixma_ appears in SCOPe 2.07
  
• d1ixma_ appears in the current release, SCOPe 2.08