Lineage for d1ixma_ (1ixm A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35567Fold d.123: Sporulation responce regulatory protein Spo0B [55889] (1 superfamily)
  4. 35568Superfamily d.123.1: Sporulation responce regulatory protein Spo0B [55890] (1 family) (S)
  5. 35569Family d.123.1.1: Sporulation responce regulatory protein Spo0B [55891] (1 protein)
  6. 35570Protein Sporulation responce regulatory protein Spo0B [55892] (1 species)
  7. 35571Species Bacillus subtilis [TaxId:1423] [55893] (2 PDB entries)
  8. 35572Domain d1ixma_: 1ixm A: [41114]

Details for d1ixma_

PDB Entry: 1ixm (more details), 2.6 Å

PDB Description: crystal structure of spoob from bacillus subtilis

SCOP Domain Sequences for d1ixma_:

Sequence, based on SEQRES records: (download)

>d1ixma_ d.123.1.1 (A:) Sporulation responce regulatory protein Spo0B {Bacillus subtilis}
sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
ltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl

Sequence, based on observed residues (ATOM records): (download)

>d1ixma_ d.123.1.1 (A:) Sporulation responce regulatory protein Spo0B {Bacillus subtilis}
sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
ltvslqtdhpdrqlilyldfhgafadpsafdimrfeitsheclieigl

SCOP Domain Coordinates for d1ixma_:

Click to download the PDB-style file with coordinates for d1ixma_.
(The format of our PDB-style files is described here.)

Timeline for d1ixma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ixmb_