Lineage for d1ixma_ (1ixm A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha)-beta(2)
  4. Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family) (S)
    Histidine kinase-like fold lacking the kinase ATP-binding site
  5. Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein)
  6. Protein Sporulation response regulatory protein Spo0B [55892] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries)
  8. Domain d1ixma_: 1ixm A: [41114]

Details for d1ixma_

PDB Entry: 1ixm (more details), 2.6 Å

PDB Description: crystal structure of spoob from bacillus subtilis
PDB Compounds: (A:) protein (sporulation response regulatory protein)

SCOPe Domain Sequences for d1ixma_:

Sequence, based on SEQRES records: (download)

>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
ltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl

Sequence, based on observed residues (ATOM records): (download)

>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
sdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnlk
tphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresenh
ltvslqtdhpdrqlilyldfhgafadpsafdimrfeitsheclieigl

SCOPe Domain Coordinates for d1ixma_ are not available.

Timeline for d1ixma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ixmb_