Lineage for d1bxda_ (1bxd A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) 
Family d.122.1.3: Histidine kinase [55884] (4 proteins) 
Protein Histidine kinase domain of the osmosensor EnvZ [55885] (1 species) Species Escherichia coli [TaxId:562] [55886] (1 PDB entry) 
Domain d1bxda_: 1bxd A: [41111]
Details for d1bxda_
PDB Entry: 1bxd (more details)
PDB Description: nmr structure of the histidine kinase domain of the e. coli osmosensor envz
SCOP Domain Sequences for d1bxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli}
tgqempmemadlnavlgeviaaesgyereietalypgsievkmhplsikravanmvvnaa
rygngwikvssgtepnrawfqveddgpgiapeqrkhlfqpfvrgdsartisgtglglaiv
qrivdnhngmlelgtsergglsirawlpvpvtraqgttkeg
SCOP Domain Coordinates for d1bxda_:
Click to download the PDB-style file with coordinates for d1bxda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bxda_:
- d1bxda_ first appeared (with stable ids) in SCOP 1.55
- d1bxda_ appears in SCOP 1.59
- d1bxda_ appears in SCOP 1.63
- d1bxda_ appears in the current release, SCOPe 2.08
View in 3D