Lineage for d6ewrb_ (6ewr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898008Species Streptococcus pneumoniae [TaxId:170187] [351651] (3 PDB entries)
  8. 2898018Domain d6ewrb_: 6ewr B: [411108]
    automated match to d6ewqd_
    complexed with pmp

Details for d6ewrb_

PDB Entry: 6ewr (more details), 2.4 Å

PDB Description: putative sugar aminotransferase spr1654 from streptococcus pneumoniae, pmp-form
PDB Compounds: (B:) putative capsular polysaccharide biosynthesis protein

SCOPe Domain Sequences for d6ewrb_:

Sequence, based on SEQRES records: (download)

>d6ewrb_ c.67.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
ynipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvclnsataale
lilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydlleqaitekt
kviipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsahalgstykgqp
sgsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgqtkdalakmq
lgsweydivtpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfagsrihplah
ktetvessrhlyitrvegasleernliiqelakagiasnvhykplplltayknlgfdmtn
ypkayaffeneitlplhtklsdeevdyiietfktvsekvltlskk

Sequence, based on observed residues (ATOM records): (download)

>d6ewrb_ c.67.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
ynipfsppditeaeitevvdtlrsgwittgpktkelerrlslytqtpktvclnsataale
lilrvlevgpgdevivpamtytascsvithvgatpvmvdiqadtfemdydlleqaitekt
kviipvelagivcdydrlfqvvekkrdfftasskwqkafnrivivsdsahalgstykgqp
sgsiadftsfsfhavknfttaeggsatwkanpviddeemykefqilslhgqtksweydiv
tpaykcnmtdimaslglvqldrypsllqrrkdivdrydsgfagsrihplahktetvessr
hlyitrvegasleernliiqelakagiasnvhykplplltayknlgfdmtnypkayaffe
neitlplhtklsdeevdyiietfktvsekvltlskk

SCOPe Domain Coordinates for d6ewrb_:

Click to download the PDB-style file with coordinates for d6ewrb_.
(The format of our PDB-style files is described here.)

Timeline for d6ewrb_:

  • d6ewrb_ is new in SCOPe 2.08-stable