Lineage for d6ev2c_ (6ev2 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (30 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760091Domain d6ev2c_: 6ev2 C: [411088]
    Other proteins in same PDB: d6ev2b2, d6ev2d2, d6ev2f2, d6ev2h2
    automated match to d6shgh_
    complexed with bgc

Details for d6ev2c_

PDB Entry: 6ev2 (more details), 2.4 Å

PDB Description: crystal structure of antibody against schizophyllan in complex with laminarihexaose
PDB Compounds: (C:) heavy chain

SCOPe Domain Sequences for d6ev2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ev2c_ b.1.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelakpgasvkmsckasgytftsywmhwvkqrpgqglewigyinpstgytey
nqkfkdkatltadkssstaymqlssltsedsavyycaplwplgtdywgqgttltvssast
kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscaa

SCOPe Domain Coordinates for d6ev2c_:

Click to download the PDB-style file with coordinates for d6ev2c_.
(The format of our PDB-style files is described here.)

Timeline for d6ev2c_:

  • d6ev2c_ is new in SCOPe 2.08-stable