Lineage for d1b62a2 (1b62 A:1-216)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580324Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2580334Protein DNA mismatch repair protein MutL [55882] (1 species)
  7. 2580335Species Escherichia coli [TaxId:562] [55883] (6 PDB entries)
  8. 2580338Domain d1b62a2: 1b62 A:1-216 [41108]
    Other proteins in same PDB: d1b62a1, d1b62a3
    protein/DNA complex; complexed with adp, mg

Details for d1b62a2

PDB Entry: 1b62 (more details), 2.1 Å

PDB Description: mutl complexed with adp
PDB Compounds: (A:) protein (mutl)

SCOPe Domain Sequences for d1b62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b62a2 d.122.1.2 (A:1-216) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
mpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirirdng
cgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqqea
wqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirrial
arfdvtinlshngkivrqyravpeggqkerrlgaic

SCOPe Domain Coordinates for d1b62a2:

Click to download the PDB-style file with coordinates for d1b62a2.
(The format of our PDB-style files is described here.)

Timeline for d1b62a2: