Lineage for d1b63a2 (1b63 A:-2-216)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1924946Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 1924956Protein DNA mismatch repair protein MutL [55882] (1 species)
  7. 1924957Species Escherichia coli [TaxId:562] [55883] (6 PDB entries)
  8. 1924958Domain d1b63a2: 1b63 A:-2-216 [41107]
    Other proteins in same PDB: d1b63a1
    protein/DNA complex; complexed with anp, edo, mg

Details for d1b63a2

PDB Entry: 1b63 (more details), 1.9 Å

PDB Description: mutl complexed with adpnp
PDB Compounds: (A:) mutl

SCOPe Domain Sequences for d1b63a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b63a2 d.122.1.2 (A:-2-216) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
ngcgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqq
eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
alarfdvtinlshngkivrqyravpeggqkerrlgaic

SCOPe Domain Coordinates for d1b63a2:

Click to download the PDB-style file with coordinates for d1b63a2.
(The format of our PDB-style files is described here.)

Timeline for d1b63a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b63a1