Lineage for d1b63a2 (1b63 A:-2-216)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333818Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 333819Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 333836Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (4 proteins)
  6. 333846Protein DNA mismatch repair protein MutL [55882] (1 species)
  7. 333847Species Escherichia coli [TaxId:562] [55883] (6 PDB entries)
  8. 333848Domain d1b63a2: 1b63 A:-2-216 [41107]
    Other proteins in same PDB: d1b63a1
    complexed with anp, edo, mg

Details for d1b63a2

PDB Entry: 1b63 (more details), 1.9 Å

PDB Description: mutl complexed with adpnp

SCOP Domain Sequences for d1b63a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b63a2 d.122.1.2 (A:-2-216) DNA mismatch repair protein MutL {Escherichia coli}
shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
ngcgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqq
eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
alarfdvtinlshngkivrqyravpeggqkerrlgaic

SCOP Domain Coordinates for d1b63a2:

Click to download the PDB-style file with coordinates for d1b63a2.
(The format of our PDB-style files is described here.)

Timeline for d1b63a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b63a1