Lineage for d6elja_ (6elj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742572Domain d6elja_: 6elj A: [411047]
    Other proteins in same PDB: d6eljb1, d6eljb2, d6eljl1, d6eljl2
    automated match to d6shgh_

Details for d6elja_

PDB Entry: 6elj (more details), 1.9 Å

PDB Description: fab fragment. abvance: increasing our knowledge of antibody structural space to enable faster and better decision making in antibody drug discovery
PDB Compounds: (A:) Fab heavy chain

SCOPe Domain Sequences for d6elja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6elja_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscatsgfdfsrywmswvrqapgkglvwigevnpdstsiny
tpslkdqftisrdnakntlylqmnslraedtavyyctrpnyygsryhyyamdywgqgtlv
tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d6elja_:

Click to download the PDB-style file with coordinates for d6elja_.
(The format of our PDB-style files is described here.)

Timeline for d6elja_:

  • d6elja_ is new in SCOPe 2.08-stable