Lineage for d6e64h_ (6e64 H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (25 PDB entries)
  8. Domain d6e64h_: 6e64 H: [411041]
    Other proteins in same PDB: d6e64b1, d6e64b2, d6e64l1, d6e64l2
    automated match to d6shgh_

Details for d6e64h_

PDB Entry: 6e64 (more details), 3.15 Å

PDB Description: crystal structure of malaria transmission-blocking antibody 85rf45.1
PDB Compounds: (H:) 85RF45.1 Fab heavy chain

SCOPe Domain Sequences for d6e64h_:

Sequence, based on SEQRES records: (download)

>d6e64h_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlvesgggllqpgrslklscvasgftfnnywmswirqapgkglewiasisniggtiyy
pdsvkgrftisrdsaqntlylqmnslrsedtatyyctrdlrmsdyfdywgqgtmvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d6e64h_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlvesgggllqpgrslklscvasgftfnnywmswirqapgkglewiasisniggtiyy
pdsvkgrftisrdsaqntlylqmnslrsedtatyyctrdlrmsdyfdywgqgtmvtvssa
stkgpsvfplapsskggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d6e64h_ are not available.

Timeline for d6e64h_:

  • d6e64h_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d6e64a_, d6e64b1, d6e64b2, d6e64l1, d6e64l2