Lineage for d1yes__ (1yes -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333818Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 333819Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 333820Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 333821Protein HSP90 [55876] (2 species)
  7. 333830Species Human (Homo sapiens) [TaxId:9606] [55878] (5 PDB entries)
  8. 333835Domain d1yes__: 1yes - [41103]

Details for d1yes__

PDB Entry: 1yes (more details), 2.2 Å

PDB Description: human hsp90 geldanamycin-binding domain, "open" conformation

SCOP Domain Sequences for d1yes__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yes__ d.122.1.1 (-) HSP90 {Human (Homo sapiens)}
pmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskl
dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadism
igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl
kedqteyleerrikeivkkhsqfigypitlfve

SCOP Domain Coordinates for d1yes__:

Click to download the PDB-style file with coordinates for d1yes__.
(The format of our PDB-style files is described here.)

Timeline for d1yes__: