Lineage for d1yes__ (1yes -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (3 families) 
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein) Protein HSP90 [55876] (2 species) Species Human (Homo sapiens) [TaxId:9606] [55878] (4 PDB entries) 
Domain d1yes__: 1yes - [41103]
Details for d1yes__
PDB Entry: 1yes (more details), 2.2 Å
PDB Description: human hsp90 geldanamycin-binding domain, "open" conformation
SCOP Domain Sequences for d1yes__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yes__ d.122.1.1 (-) HSP90 {Human (Homo sapiens)}
pmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskl
dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadism
igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl
kedqteyleerrikeivkkhsqfigypitlfve
SCOP Domain Coordinates for d1yes__:
Click to download the PDB-style file with coordinates for d1yes__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yes__:
- d1yes__ appears in SCOP 1.57
- d1yes__ appears in the current release, SCOPe 2.08, called d1yesa_
View in 3D