Lineage for d1yesa_ (1yes A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. Protein HSP90 [55876] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. Domain d1yesa_: 1yes A: [41103]

Details for d1yesa_

PDB Entry: 1yes (more details), 2.2 Å

PDB Description: human hsp90 geldanamycin-binding domain, "open" conformation
PDB Compounds: (A:) heat shock protein 90

SCOPe Domain Sequences for d1yesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yesa_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
pmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskl
dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadism
igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl
kedqteyleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d1yesa_ are not available.

Timeline for d1yesa_: