Lineage for d6dnzd_ (6dnz D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895093Species Trypanosoma brucei [TaxId:185431] [369671] (1 PDB entry)
  8. 2895097Domain d6dnzd_: 6dnz D: [411000]
    automated match to d2v7ea_
    complexed with gol, sah, trs

Details for d6dnzd_

PDB Entry: 6dnz (more details), 2.38 Å

PDB Description: trypanosoma brucei prmt1 enzyme-prozyme heterotetrameric complex with adohcy
PDB Compounds: (D:) Arginine N-methyltransferase, putative

SCOPe Domain Sequences for d6dnzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dnzd_ c.66.1.0 (D:) automated matches {Trypanosoma brucei [TaxId: 185431]}
risgnlscihdrvrlrayesvlrsikgksvlhlgcgmglvsmiaarslasavvavdrsai
vdaaqvvanknglnnisffrgalvdvvqnfpvrqfdviicewmgpflindplleealyar
nnllasngvmcpdsssihvvgvsdycfhmdtvefwgnvygfkmepmkalvqrevemcrvp
tssivtttclahtvniasinnlddksslndfvvpfsvratkdttvnfltfyidarftnph
dpganfvlgvrpggtnpwtetsvalheplplkggevlsgelkvcllnptrgittvevtar
tsgnvvnietkgtynyqry

SCOPe Domain Coordinates for d6dnzd_:

Click to download the PDB-style file with coordinates for d6dnzd_.
(The format of our PDB-style files is described here.)

Timeline for d6dnzd_:

  • d6dnzd_ is new in SCOPe 2.08-stable