Lineage for d6cmgc_ (6cmg C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757470Domain d6cmgc_: 6cmg C: [410943]
    Other proteins in same PDB: d6cmgb2
    automated match to d6shgh_
    complexed with nag

Details for d6cmgc_

PDB Entry: 6cmg (more details), 2.7 Å

PDB Description: crystal structure of the hendra virus attachment g glycoprotein bound to a potent cross-reactive neutralizing human monoclonal antibody m102.3
PDB Compounds: (C:) IGG Heavy chain

SCOPe Domain Sequences for d6cmgc_:

Sequence, based on SEQRES records: (download)

>d6cmgc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkrgssvkvsckssggtfsnyainwvrqapgqglewmggiipilgiany
aqkfqgrvtittdeststaymelsslrsedtavyycargwgreqlaphpsqyyyyyygmd
vwgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts
gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d6cmgc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkrgssvkvsckssggtfsnyainwvrqapgqglewmggiipilgiany
aqkfqgrvtittdeststaymelsslrsedtavyycargwgreqlaphpsqyyyyyygmd
vwgqgttvtvssastkgpsvfplapggtaalgclvkdyfpepvtvswnsgaltsgvhtfp
avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d6cmgc_:

Click to download the PDB-style file with coordinates for d6cmgc_.
(The format of our PDB-style files is described here.)

Timeline for d6cmgc_:

  • d6cmgc_ is new in SCOPe 2.08-stable