Lineage for d6ca7h_ (6ca7 H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d6ca7h_: 6ca7 H: [410934]
    Other proteins in same PDB: d6ca7l1, d6ca7l2
    automated match to d6shgh_

Details for d6ca7h_

PDB Entry: 6ca7 (more details), 1.6400000000000001 Å

PDB Description: crystal structure of pct64_13c, a strain specific anti-hiv antibody
PDB Compounds: (H:) PCT64_13C heavy chain

SCOPe Domain Sequences for d6ca7h_:

Sequence, based on SEQRES records: (download)

>d6ca7h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvkpggslrlscaasgftftnawldwvrqapgkglewvgriksktdggtt
dhaapvkgrftisrddskntvylqmnslkiedtavyycttgvetydfwsgyddhyydyyf
kdvwgkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgal
tsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk

Sequence, based on observed residues (ATOM records): (download)

>d6ca7h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvkpggslrlscaasgftftnawldwvrqapgkglewvgriksktdggtt
dhaapvkgrftisrddskntvylqmnslkiedtavyycttgvetydfwsgyddhyydyyf
kdvwgkgttvtvssastkgpsvfplapsskststaalgclvkdyfpepvtvswnsgalts
gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk

SCOPe Domain Coordinates for d6ca7h_ are not available.

Timeline for d6ca7h_:

  • d6ca7h_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d6ca7l1, d6ca7l2