Lineage for d6c08a_ (6c08 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. Domain d6c08a_: 6c08 A: [410913]
    automated match to d6shgh_
    complexed with arg

Details for d6c08a_

PDB Entry: 6c08 (more details), 3.17 Å

PDB Description: zebrafish slc38a9 with arginine bound in the cytosol open state
PDB Compounds: (A:) antibody fab heavy chain

SCOPe Domain Sequences for d6c08a_:

Sequence, based on SEQRES records: (download)

>d6c08a_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqlvqsgpklskpggtdkisskasgysftdyvmnwvkagpgkglewngsintsngytty
isafkgrgsfsvdssastaaqqlsvlkaaatavyfnarnfrgngamdywgqgtsvtvssa
kttapsvyplevsxxxxtgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlasdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Sequence, based on observed residues (ATOM records): (download)

>d6c08a_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqlvqsgpklskpggtdkisskasgysftdyvmnwvkagpgkglewngsintsngytty
isafkgrgsfsvdssastaaqqlsvlkaaatavyfnarnfrgngamdywgqgtsvtvssa
kttapsvyplevstgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlasdlytls
ssvtvtsstwpsqsitcnvahpasstkvdkkiep

SCOPe Domain Coordinates for d6c08a_ are not available.

Timeline for d6c08a_:

  • d6c08a_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d6c08b1, d6c08b2, d6c08d_, d6c08e1, d6c08e2