Lineage for d6by2a1 (6by2 A:6-219)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. Domain d6by2a1: 6by2 A:6-219 [410908]
    Other proteins in same PDB: d6by2a2, d6by2b1, d6by2b2, d6by2c1, d6by2c2
    automated match to d6shgh_
    complexed with dga, f09, k; mutant

Details for d6by2a1

PDB Entry: 6by2 (more details), 2.3499999999999996 Å

PDB Description: closed and deep-inactivated conformation of kcsa-t75a mutant
PDB Compounds: (A:) antibody heavy chain

SCOPe Domain Sequences for d6by2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6by2a1 b.1.1.1 (A:6-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygranynekiq
kkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssakttpps
vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpssswpsetvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d6by2a1 are not available.

Timeline for d6by2a1:

  • d6by2a1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6by2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6by2b1, d6by2b2, d6by2c1, d6by2c2