SCOPe 2.06: Domain d1soxa2: 1sox A:3-93

Lineage for d1soxa2 (1sox A:3-93)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
   beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)

4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families)

5. Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)

6. Protein Sulfite oxidase, N-terminal domain [55866] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [55867] (1 PDB entry)

8. Domain d1soxa2: 1sox A:3-93 [41090]
   Other proteins in same PDB: d1soxa1, d1soxa3, d1soxb1, d1soxb3
   complexed with epe, gol, hem, mo, mte, so4

Details for d1soxa2

PDB Entry: 1sox, 1.9 Å

PDB Description: sulfite oxidase from chicken liver

PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d1soxa2:

Sequence, based on SEQRES records:

>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
avhgephvlellqqykvgelspdeapaapda

Sequence, based on observed residues (ATOM records):

>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
sypeytreevgrhrspeervwvthgtdvfdvtdfvelhpggpdkillaaggalepfwaly
avhgephvlellqqykvgelspdeapapda

Timeline for d1soxa2:

• d1soxa2 first appeared (with stable ids) in SCOP 1.55
  
• d1soxa2 appears in SCOPe 2.05
  
• d1soxa2 appears in SCOPe 2.07
  
• d1soxa2 appears in the current release, SCOPe 2.08