SCOP 1.65: Domain d1ldca2: 1ldc A:10-97

Lineage for d1ldca2 (1ldc A:10-97)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.120: Cytochrome b5 [55855] (1 superfamily)
   small, heme-binding fold

4. Superfamily d.120.1: Cytochrome b5 [55856] (1 family)

5. Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)

6. Protein Flavocytochrome b2, N-terminal domain [55864] (1 species)
   C-terminal domain is beta/alpha barrel

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (5 PDB entries)

8. Domain d1ldca2: 1ldc A:10-97 [41089]
   Other proteins in same PDB: d1ldca1, d1ldcb_
   complexed with fmn, hem, pyr; mutant

Details for d1ldca2

PDB Entry: 1ldc, 2.9 Å

PDB Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate

SCOP Domain Sequences for d1ldca2:

Sequence; same for both SEQRES and ATOM records:

>d1ldca2 d.120.1.1 (A:10-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifeplhapn
vidkyiapekklgplqgsmppelvcppy

Timeline for d1ldca2:

• d1ldca2 first appeared (with stable ids) in SCOP 1.55
  
• d1ldca2 appears in SCOP 1.63
  
• d1ldca2 appears in SCOP 1.67
  
• d1ldca2 appears in the current release, SCOPe 2.08