Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.120: Cytochrome b5 [55855] (1 superfamily) small, heme-binding fold |
Superfamily d.120.1: Cytochrome b5 [55856] (1 family) |
Family d.120.1.1: Cytochrome b5 [55857] (4 proteins) |
Protein Flavocytochrome b2, N-terminal domain [55864] (1 species) C-terminal domain is beta/alpha barrel |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (5 PDB entries) |
Domain d1ldca2: 1ldc A:10-97 [41089] Other proteins in same PDB: d1ldca1, d1ldcb_ complexed with fmn, hem, pyr; mutant |
PDB Entry: 1ldc (more details), 2.9 Å
SCOP Domain Sequences for d1ldca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldca2 d.120.1.1 (A:10-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} kispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifeplhapn vidkyiapekklgplqgsmppelvcppy
Timeline for d1ldca2: