SCOPe 2.08: Domain d6bf4h_: 6bf4 H:

Lineage for d6bf4h_ (6bf4 H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6bf4h_: 6bf4 H: [410881]
   Other proteins in same PDB: d6bf4c1, d6bf4c2, d6bf4l1, d6bf4l2
   automated match to d6shgh_
   complexed with act, edo, nag

Details for d6bf4h_

PDB Entry: 6bf4, 2.38 Å

PDB Description: crystal structure of hiv-1 clade ae strain cne55 gp120 core in complex with neutralizing antibody vrc-pg05 that targets the center of the silent face on the outer domain of gp120

PDB Compounds: (H:) VRC-PG05 Fab heavy chain

SCOPe Domain Sequences for d6bf4h_:

Sequence, based on SEQRES records:

>d6bf4h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfpfnrdwmtwvrqapgkglewvaninmdgdkkdy
vdsvkgrftisrdnaktslylqmnslragdtavyycarirqvskylqwypgvfemwgqgt
mvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfp
avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d6bf4h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfpfnrdwmtwvrqapgkglewvaninmdgdkkdy
vdsvkgrftisrdnaktslylqmnslragdtavyycarirqvskylqwypgvfemwgqgt
mvtvssastkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d6bf4h_:

• d6bf4h_ is new in SCOPe 2.08-stable