Lineage for d1lcoa2 (1lco A:10-97)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510360Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 510361Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (2 families) (S)
  5. 510362Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 510415Protein Flavocytochrome b2, N-terminal domain [55864] (1 species)
    C-terminal domain is beta/alpha barrel
  7. 510416Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (5 PDB entries)
  8. 510420Domain d1lcoa2: 1lco A:10-97 [41088]
    Other proteins in same PDB: d1lcoa1, d1lcob_

Details for d1lcoa2

PDB Entry: 1lco (more details), 2.9 Å

PDB Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate

SCOP Domain Sequences for d1lcoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcoa2 d.120.1.1 (A:10-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifeplhapn
vidkyiapekklgplqgsmppelvcppy

SCOP Domain Coordinates for d1lcoa2:

Click to download the PDB-style file with coordinates for d1lcoa2.
(The format of our PDB-style files is described here.)

Timeline for d1lcoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lcoa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1lcob_