SCOP 1.67: Domain d1lcoa2: 1lco A:10-97

Lineage for d1lcoa2 (1lco A:10-97)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
   beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)

4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (2 families)

5. Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)

6. Protein Flavocytochrome b2, N-terminal domain [55864] (1 species)
   C-terminal domain is beta/alpha barrel

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (5 PDB entries)

8. Domain d1lcoa2: 1lco A:10-97 [41088]
   Other proteins in same PDB: d1lcoa1, d1lcob_
   complexed with fmn, hem, ppy; mutant

Details for d1lcoa2

PDB Entry: 1lco, 2.9 Å

PDB Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate

SCOP Domain Sequences for d1lcoa2:

Sequence; same for both SEQRES and ATOM records:

>d1lcoa2 d.120.1.1 (A:10-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
kispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifeplhapn
vidkyiapekklgplqgsmppelvcppy

Timeline for d1lcoa2:

• d1lcoa2 first appeared (with stable ids) in SCOP 1.55
  
• d1lcoa2 appears in SCOP 1.65
  
• d1lcoa2 appears in SCOP 1.69
  
• d1lcoa2 appears in the current release, SCOPe 2.08