Lineage for d1fcba2 (1fcb A:1-97)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429571Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 1429572Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 1429573Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 1429628Protein Flavocytochrome b2, N-terminal domain [55864] (1 species)
    C-terminal domain is beta/alpha barrel
  7. 1429629Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (6 PDB entries)
  8. 1429632Domain d1fcba2: 1fcb A:1-97 [41087]
    Other proteins in same PDB: d1fcba1, d1fcbb_
    complexed with fmn, hem, pyr

Details for d1fcba2

PDB Entry: 1fcb (more details), 2.4 Å

PDB Description: molecular structure of flavocytochrome b2 at 2.4 angstroms resolution
PDB Compounds: (A:) flavocytochrome b2

SCOPe Domain Sequences for d1fcba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcba2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
ifeplhapnvidkyiapekklgplqgsmppelvcppy

SCOPe Domain Coordinates for d1fcba2:

Click to download the PDB-style file with coordinates for d1fcba2.
(The format of our PDB-style files is described here.)

Timeline for d1fcba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcba1
View in 3D
Domains from other chains:
(mouse over for more information)
d1fcbb_