SCOPe 2.02: Domain d1fcba2: 1fcb A:1-97

Lineage for d1fcba2 (1fcb A:1-97)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
   beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)

4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families)

5. Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)

6. Protein Flavocytochrome b2, N-terminal domain [55864] (1 species)
   C-terminal domain is beta/alpha barrel

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (6 PDB entries)

8. Domain d1fcba2: 1fcb A:1-97 [41087]
   Other proteins in same PDB: d1fcba1, d1fcbb_
   complexed with fmn, hem, pyr

Details for d1fcba2

PDB Entry: 1fcb, 2.4 Å

PDB Description: molecular structure of flavocytochrome b2 at 2.4 angstroms resolution

PDB Compounds: (A:) flavocytochrome b2

SCOPe Domain Sequences for d1fcba2:

Sequence; same for both SEQRES and ATOM records:

>d1fcba2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
ifeplhapnvidkyiapekklgplqgsmppelvcppy

Timeline for d1fcba2:

• d1fcba2 first appeared (with stable ids) in SCOP 1.55
  
• d1fcba2 appears in SCOPe 2.01
  
• d1fcba2 appears in SCOPe 2.03
  
• d1fcba2 appears in the current release, SCOPe 2.08