![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
![]() | Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (2 families) ![]() |
![]() | Family d.120.1.1: Cytochrome b5 [55857] (4 proteins) |
![]() | Protein Flavocytochrome b2, N-terminal domain [55864] (1 species) C-terminal domain is beta/alpha barrel |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (6 PDB entries) |
![]() | Domain d1ltda2: 1ltd A:10-97 [41086] Other proteins in same PDB: d1ltda1, d1ltdb_ complexed with fmn, hem, so3 |
PDB Entry: 1ltd (more details), 2.6 Å
SCOP Domain Sequences for d1ltda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ltda2 d.120.1.1 (A:10-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifeplhapn vidkyiapekklgplqgsmppelvcppy
Timeline for d1ltda2: