Lineage for d6b6zb_ (6b6z B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188740] (689 PDB entries)
  8. Domain d6b6zb_: 6b6z B: [410840]
    Other proteins in same PDB: d6b6za1, d6b6za2, d6b6zc1, d6b6zc2
    automated match to d6shgh_
    complexed with zn

Details for d6b6zb_

PDB Entry: 6b6z (more details), 2.11 Å

PDB Description: crystal structure of the apo antibody fragment (fab) raised against c- terminal domain of ebola nucleoprotein (ebov, tafv, bdbv strains)
PDB Compounds: (B:) Apo Fab Heavy Chain

SCOPe Domain Sequences for d6b6zb_:

Sequence, based on SEQRES records: (download)

>d6b6zb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfnvyyyyihwvrqapgkglewvasispyygytsy
adsvkgrftisadtskntaylqmnslraedtavyycarwsydqsmsyksgmdywgqgtlv
tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d6b6zb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgfnvyyyyihwvrqapgkglewvasispyygytsy
adsvkgrftisadtskntaylqmnslraedtavyycarwsyksgmdywgqgtlvtvssas
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d6b6zb_ are not available.

Timeline for d6b6zb_:

  • d6b6zb_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d6b6za1, d6b6za2, d6b6zc1, d6b6zc2, d6b6zd_