Lineage for d1do9a_ (1do9 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417732Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 417733Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (2 families) (S)
  5. 417734Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 417735Protein Cytochrome b5 [55858] (3 species)
  7. 417751Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55861] (1 PDB entry)
  8. 417752Domain d1do9a_: 1do9 A: [41084]

Details for d1do9a_

PDB Entry: 1do9 (more details)

PDB Description: solution structure of oxidized microsomal rabbit cytochrome b5. factors determining the heterogeneous binding of the heme.

SCOP Domain Sequences for d1do9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1do9a_ d.120.1.1 (A:) Cytochrome b5 {Rabbit (Oryctolagus cuniculus)}
dkdvkyytleeikkhnhskstwlilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktfiigelhpddrsklskpmetl

SCOP Domain Coordinates for d1do9a_:

Click to download the PDB-style file with coordinates for d1do9a_.
(The format of our PDB-style files is described here.)

Timeline for d1do9a_: