Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (2 families) |
Family d.120.1.1: Cytochrome b5 [55857] (4 proteins) |
Protein Cytochrome b5 [55858] (3 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55861] (1 PDB entry) |
Domain d1do9a_: 1do9 A: [41084] |
PDB Entry: 1do9 (more details)
SCOP Domain Sequences for d1do9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1do9a_ d.120.1.1 (A:) Cytochrome b5 {Rabbit (Oryctolagus cuniculus)} dkdvkyytleeikkhnhskstwlilhhkvydltkfleehpggeevlreqaggdatenfed vghstdarelsktfiigelhpddrsklskpmetl
Timeline for d1do9a_: