Lineage for d1do9a_ (1do9 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333747Fold d.120: Cytochrome b5 [55855] (1 superfamily)
    small, heme-binding fold
  4. 333748Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 333749Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 333750Protein Cytochrome b5 [55858] (3 species)
  7. 333765Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55861] (1 PDB entry)
  8. 333766Domain d1do9a_: 1do9 A: [41084]

Details for d1do9a_

PDB Entry: 1do9 (more details)

PDB Description: solution structure of oxidized microsomal rabbit cytochrome b5. factors determining the heterogeneous binding of the heme.

SCOP Domain Sequences for d1do9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1do9a_ d.120.1.1 (A:) Cytochrome b5 {Rabbit (Oryctolagus cuniculus)}
dkdvkyytleeikkhnhskstwlilhhkvydltkfleehpggeevlreqaggdatenfed
vghstdarelsktfiigelhpddrsklskpmetl

SCOP Domain Coordinates for d1do9a_:

Click to download the PDB-style file with coordinates for d1do9a_.
(The format of our PDB-style files is described here.)

Timeline for d1do9a_: