Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (2 families) |
Family d.120.1.1: Cytochrome b5 [55857] (4 proteins) |
Protein Cytochrome b5 [55858] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries) |
Domain d1b5a__: 1b5a - [41080] complexed with hem |
PDB Entry: 1b5a (more details)
SCOP Domain Sequences for d1b5a__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b5a__ d.120.1.1 (-) Cytochrome b5 {Rat (Rattus norvegicus)} dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed vghstdarelsktyiigelhpddrskiakpsetl
Timeline for d1b5a__: